SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1KKJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1KKJ2
Domain Number 1 Region: 179-486
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 4.9e-113
Family Glucose 6-phosphate dehydrogenase-like 0.00000195
Further Details:      
 
Domain Number 2 Region: 4-187
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.36e-51
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1KKJ2
Sequence length 489
Comment (tr|A0A0C1KKJ2|A0A0C1KKJ2_9PSED) Glucose-6-phosphate 1-dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00966} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_04810 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAAISVEPCTFALFGALGDLALRKLFPALYQLDRANLLHPETRLLALAREAGSAQGHLDS
IEAHLRRHVPEADIEPAALGRFLARLSYQHLDFLQPEGYQALAEQLPDELPLIAYFATAA
AVYGAICENLDKAGLAARTRVVLEKPIGHDLESSRRVNDAVARFFPESRVYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNSISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQ
LLCLIAMDPPSELSADAIRDEKVKVLKALAPITGEGLSTRVVRGQYIAGYSDGKPVPGYL
EEDNANAQSDTETFVALRADIRNWRWSGVPFYLRTGKRMPQKLSQIVIHFKETPHYIFAP
EQRLQIGNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTWRSARIPDAYE
RLLLEVMRGNQNLFVRKDEIEYAWKWCDQLIAGWRNAGDAPKPYAAGSWGPMSSIALITR
DGRAWYGDI
Download sequence
Identical sequences A0A059UTI2 A0A099MU46 A0A0C1KKJ2 A0A136QKZ8 F8FXC0 V7DBV4 V9UTD2
2035954618 gi|339485978|ref|YP_004700506.1| gi|568185972|ref|YP_008958495.1| WP_013971130.1.1643 WP_013971130.1.23948 WP_013971130.1.28354 WP_013971130.1.35335 WP_013971130.1.56258 WP_013971130.1.65739 WP_013971130.1.7288 WP_013971130.1.7435 WP_013971130.1.80759 gi|568180541|ref|YP_008953066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]