SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1KM28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1KM28
Domain Number 1 Region: 2-302
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.55e-109
Family Glutaminase 0.00000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1KM28
Sequence length 302
Comment (tr|A0A0C1KM28|A0A0C1KM28_9PSED) Glutaminase {ECO:0000256|HAMAP-Rule:MF_00313, ECO:0000256|SAAS:SAAS00041476} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_23310 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQTLLNEILEEVRPLIGKGKVADYIPALADVPANQLGIAVYGNDGSYYCAGDALVPFSVQ
SISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPTLSMRDFVRRLSGNPHISIDARVADSEYQFRARNAAMAYLMQSFGNFHNEVE
TVLRSYFSYCALQMNCLDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAIVPGQFTVCVWSPELNAAGNSLAGMAALELLSSRIGWS
VF
Download sequence
Identical sequences A0A0C1KM28 F8G069 V9UZ89
gi|339486960|ref|YP_004701488.1| gi|568186856|ref|YP_008959400.1| gi|568181477|ref|YP_008954030.1| WP_013972011.1.23948 WP_013972011.1.28354 WP_013972011.1.56258 WP_013972011.1.7288 WP_013972011.1.7435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]