SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1PL48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1PL48
Domain Number 1 Region: 48-173
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.03e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000662
Further Details:      
 
Domain Number 2 Region: 4-48,174-228
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.49e-34
Family RNA polymerase alpha subunit dimerisation domain 0.00056
Further Details:      
 
Domain Number 3 Region: 249-314
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 5.23e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1PL48
Sequence length 316
Comment (tr|A0A0C1PL48|A0A0C1PL48_LACBR) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=1580 OS=Lactobacillus brevis. GN=AZI09_03570 OC=Lactobacillus.
Sequence
MIEFEKPNIHKIDESNNYGKFIVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDGVL
HEFSTVEGVVEDVTQIILNVKKIALKLNGSDDQEETMEINVKGPAQITAGDIVAGADVDI
LNPDLYIATVADGATFHMRMTADKGRGYVSADENKTRNTDMPIGVLAVDSIYTPIERVNY
QVENARVGQRADYDKLTLDVWTNGSINPSEAIALAAKILTEHLAMFVDLTDEAKNAEIMV
EKEETHKEKMLEMTIEELDLSVRSYNCLKRAGINTVQELNNKTEADMMKVRNLGRKSLEE
VKAKLADLGLSLRKED
Download sequence
Identical sequences A0A0A7U1N0 A0A0C1PL48 M5AFP7 Q03PY3 U2QZ50
gi|116334243|ref|YP_795770.1| gi|472407340|ref|YP_007654445.1| 387344.LVIS_1664 WP_011668473.1.1001 WP_011668473.1.101817 WP_011668473.1.101959 WP_011668473.1.10245 WP_011668473.1.12110 WP_011668473.1.12992 WP_011668473.1.14555 WP_011668473.1.30569 WP_011668473.1.33510 WP_011668473.1.34389 WP_011668473.1.35134 WP_011668473.1.35844 WP_011668473.1.41999 WP_011668473.1.47372 WP_011668473.1.49372 WP_011668473.1.51823 WP_011668473.1.56537 WP_011668473.1.57633 WP_011668473.1.61846 WP_011668473.1.6335 WP_011668473.1.63668 WP_011668473.1.67033 WP_011668473.1.67380 WP_011668473.1.68109 WP_011668473.1.71826 WP_011668473.1.74392 WP_011668473.1.78399 WP_011668473.1.79023 WP_011668473.1.80197 WP_011668473.1.8329 WP_011668473.1.85477 WP_011668473.1.86233 WP_011668473.1.86414 WP_011668473.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]