SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2WR41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2WR41
Domain Number 1 Region: 24-210
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.73e-19
Family Phosphate binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2WR41
Sequence length 293
Comment (tr|A0A0C2WR41|A0A0C2WR41_AMAMU) Uncharacterized protein {ECO:0000313|EMBL:KIL58758.1} KW=Complete proteome; Reference proteome OX=946122 OS=Amanita muscaria Koide BX008. GN=M378DRAFT_188157 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MVLRIGYVREHFSSPLLQYNEDDKGQTFTLVECPGGTGQLISRLEGGEIDIAVALTDALI
SGIAKGSKAYKLVGSYVSTPLNWAVITGKNTAFNAISDLEGTTLGISRPGSGSQTMAYVM
SLQNGWETDALKFQVNNNIRGLIESVNDGSTSAFMWEWFTTKPFLDAGEVRFIGSVPTPW
PSWMIVAHQSTERAPVEAVQRFLLNLTRYVRRFDSEESRASSNITFIKEKFGYPEEDINA
WLKTVRYPEDCITVSRQVIHDTLSILEKAGVVTAPPSGFQLNDFVETNIATLT
Download sequence
Identical sequences A0A0C2WR41
jgi|Amamu1|188157|fgenesh1_pm.109_#_18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]