SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9PUD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9PUD7
Domain Number 1 Region: 578-702
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-38
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 887-976
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-20
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-19
Family PDZ domain 0.0069
Further Details:      
 
Domain Number 4 Region: 202-313
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-16
Family Phosphotyrosine-binding domain (PTB) 0.0062
Further Details:      
 
Domain Number 5 Region: 832-898
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000165
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9PUD7
Sequence length 1293
Comment (tr|A0A0C9PUD7|A0A0C9PUD7_9HYME) Loco_0 protein {ECO:0000313|EMBL:JAG74750.1} OX=64838 OS=Fopius arisanus. GN=g.7615 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MHHNRRKKKRINYGVRAVELMRGSKGFGFTISGQQPCILSCIVAGSPAEIAGLRAGDYLV
TVNGHNVGKAPHDDVVRLIGHSKGILRLQIAENYYSDSSDEEGPAASRSKPKYSHKQRNS
NATPVASGPAPAGQLQCRVAKVVRDLQSGAMFTGGEGERVVQSKILCSQNGVYHRWNMAS
APLPPPPHSHKRDAEKIVHRTVVGYLGTIDIPNQLHPSTMMPVLRKCIKRLKAEKRTPTT
VLLTIHVANIKLTNSENKIIAEYPSHRIVFCNSFSEQDKQYFGIVTKSANHTDEIVSNSC
HVFTIYYKLIEHAVHLSTCNMFGFTCTKTSELTVCQEFPDSCNGLIGAIQTLYISETTDS
EAFPESNRRQRREAVSPQPSNISTSTAHSSNSDSGIGFKDEYGSHYSATERNINLDFSHR
RLPIPSNSRLTVRATQDSQNERGISNGDGGTRDGGDITCPGPSAALSMTKLDASSVGSST
FSRTIAGMLRTVDAEDMEFCDTAGDKLSPKVFNASKTLVHSMEDLKNEGEAVDVFAKPAD
VRPWGSLQEIRNVGGFQSNSSLYGSVESCDKNDAGLGVRSWGAGFENLLKDPRGLQTFAE
FLKKEFSHENIYFWAACERYKDTEDATSRRRLAWQIYQRHLSNNAPEPVNVDSHAAGQIT
QELLNRAPEELFLQAQKQVFNLMKFDSYPRFLKSNLYHQCKENGIGVRTEDHDLDLTSSP
SVKLKKSHSDAEDRCRKSILPWHRKNRSKSKDRGESEYNKTPSRGEPIYKSFTTIKRDTE
GNNNDDTISISSSRSSLASWDLALRQSFSKHSLSSYDGHNDKKEVQTKCTGLCRVILPDG
STTVVPTSQTESIKDVVTRLLEKRALRYTNYDVLVLATDEMINLKYSSSVLAGQEVEVVP
TKALKVDLPSRRIITVVAHKNRTLREVLRPLLNKYGFKLELITIWGEGHPVSLEIPAINA
PSRLVLTSNNEDFQRDSLHYQEDIEQGQSQLDEITNKVFEELLVGKSTNKYYSEGSYKSD
DQRSEGSSILSSKLFTRDTTVLGKKKGKSKSSNLSEKSNSTDYTGEESSQSSRPHAPLIA
KWRNGVKLQLPGRFDGDELYEGLKRAQRSRLEDQRGTEINFELPDFLKQNKENGKHTETK
KHRRGRLLGLSSDCASKFYDSSDDIKKANLVSNPVFEKCHYNSEEGQPISKPLEPSKRFD
SVSSLDGTLEDVDKTIIENGNGPNQPKDSFFENQFVTGSPGKLSKPPPLPPKPKGLLTCA
VKTSQILPTKPLPRVTQISPITPLESRENKNIF
Download sequence
Identical sequences A0A0C9PUD7
XP_011302707.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]