SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9WDV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9WDV3
Domain Number 1 Region: 36-364
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-58
Family Pyruvate oxidase and decarboxylase PP module 0.074
Further Details:      
 
Domain Number 2 Region: 404-613
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.06e-20
Family TK-like Pyr module 0.079
Further Details:      
 
Domain Number 3 Region: 621-759
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000628
Family Transketolase C-terminal domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9WDV3
Sequence length 822
Comment (tr|A0A0C9WDV3|A0A0C9WDV3_9HOMO) Unplaced genomic scaffold scaffold_19, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ62782.1} KW=Complete proteome; Reference proteome OX=994086 OS=Hydnomerulius pinastri MD-312. GN=HYDPIDRAFT_41494 OC=Hydnomerulius.
Sequence
MAAQCIDQPNPPPDPSQLPDSMLDYRVQTGTGYVISASELDSVRKFRRAANYIAAAMIFL
KDNVLLERQLTFDDVKPRLLGHWGTCPGLVLVYAHLNRIVKKTDLDALLVVGPGHGAPAI
LSCLWLENSLAPFWQPYTRDRAGLTRLITKFSAPGGFPSHINAETPGCIHEGGELGYALS
VAFGAVMDNPQLVVACVVGDGEAETGPTATAWHGFKYIDPAESGAVLPIVHVNGFKISER
TIYGCMDDKELIALFSGYGYQVRIVDDLGSIDQDLATSMEWALGEISRIQHSARSGSPII
KPRWPVLILRTPKGWSGPKELHGEFIEGSFRSHQVPLPEAKTSEEELQMLQAWLSSYHPE
ELFTIGSGEGAVDGAPVTDLLKIIPDNKEKRLGTRKEAYAAFQPLDVPDWMPFGIERGLE
ASCMKTIGNFLREVIKENPSTFRIFSPDELVSNKLDAVFDVTGRNFQWDVTSSARGGRII
EILSEHTCQGMIQGYTLTGRTALFPTYEAFLGIVHTMMVQYSKFTKMARETDWRHDVGSV
NYLETSTWARQEHNGFSHQNPSFIGAVLNLKATLARVYLPPDANCFLSTMAHCLKAKNYI
NLMVGSKQPTSVWLSPEEADRHCVAGASVWKFASVDDGIDPDVVLVGIGTEVTFEVIAAA
ALLRKHLPALRVRVINVTDLMILGPHGSHPHALSDEDFDTLFTKDRHVIINYHGYPIEVK
GLLFGRPGVDRMSIEGYREEGTTTSPFDMMLCNHVSRYHVAAAAVRAGALFNQKVSIEAH
EKASFIMHLAQKDREYIQRDGRDPDGTFDTPVFEDAMKEQKK
Download sequence
Identical sequences A0A0C9WDV3
jgi|Hydpi2|41494|estExt_Genemark1.C_190027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]