SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9ZY01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9ZY01
Domain Number 1 Region: 172-391
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.97e-92
Family ATP sulfurylase catalytic domain 0.0000000156
Further Details:      
 
Domain Number 2 Region: 4-171
Classification Level Classification E-value
Superfamily PUA domain-like 4.57e-53
Family ATP sulfurylase N-terminal domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 392-507,544-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.69e-30
Family ATP sulfurylase C-terminal domain 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9ZY01
Sequence length 575
Comment (tr|A0A0C9ZY01|A0A0C9ZY01_9HOMO) Sulfate adenylate transferase {ECO:0000256|HAMAP-Rule:MF_03106} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_220751 OC=Pisolithaceae; Pisolithus.
Sequence
MANTPHGGVLKDLVARDEHISEHLRAEAATLGDIILTERQLCDLELILNGGFSPLEGFMN
ECDYNSVVDTLRLSDGTLFPMPITLDVSSDDIKRLGLSPTARIVLRDPRDDEALAILTVE
DVFAYDRVKEAIQVFGADDPAHPSVAYLRNRAKEYYVGGKVQAIQTPPHFDYVAFRYTPA
ELRAHFKKLSWRRVVAFQTRNPMHRAHRELTVRAARQQQANVLIHPVVGLTKPGDVDHYT
RVRVYQAIMAKYPNGMAHLALLPLAMRMAGPREALWHAIIRKNYGATHFIVGRDHAGPGK
NSQGRDFYGPYDAQELVERFKDELQIEMVPFQQMTYVPATDEYVPVDEIPAGVQTSNISG
TELRRRLRTGVSIPDWFSYEDVVAKLRESYPPRNKQGFVLFLTGLYNSGKDAIAKALQVA
LNEQGGRSVSLLIGESMGDDSNEKLGLTVEERHENLQRIAFVASELARAGAAVIAAPTSP
EERSRTFVKDKIASSSGAGGNFFLIHVATPLAHCEGTDRRGLYARARSGAIPGFVGIDVE
YENPKQADLVVDVSVQSIPAIVHSIILLLETSSLI
Download sequence
Identical sequences A0A0C9ZY01
jgi|Pismi1|220751|CE96299_13315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]