SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0KED9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0KED9
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0KED9
Sequence length 109
Comment (tr|A0A0D0KED9|A0A0D0KED9_XANCA) Anti-anti-sigma factor {ECO:0000313|EMBL:KIQ24462.1} KW=Complete proteome OX=339 OS=Xanthomonas campestris. GN=RT95_15370 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MDIFSLDLPAPLTLALEGEMTIRRAAELKPLLQPALAHPGGVRLDLAAVSEIDTTGLQLL
LATKQAVQADGRPFVLTDSSRAVVDVIELLGLLEALYPHAATGLGERIH
Download sequence
Identical sequences A0A0D0KED9 A0A0H2X7H9 B0RQS7 G0CLU0 Q8P7B2
NP_638047.1.47755 WP_011037829.1.10627 WP_011037829.1.12135 WP_011037829.1.12496 WP_011037829.1.15229 WP_011037829.1.16446 WP_011037829.1.1732 WP_011037829.1.18295 WP_011037829.1.1936 WP_011037829.1.22538 WP_011037829.1.25266 WP_011037829.1.27778 WP_011037829.1.31612 WP_011037829.1.36111 WP_011037829.1.36449 WP_011037829.1.40219 WP_011037829.1.40437 WP_011037829.1.43481 WP_011037829.1.4502 WP_011037829.1.475 WP_011037829.1.56666 WP_011037829.1.82601 WP_011037829.1.88278 WP_011037829.1.89271 gi|66767741|ref|YP_242503.1| gi|188990858|ref|YP_001902868.1| 190485.XCC2699 314565.XC_1415 509169.xccb100_1462 gi|384428683|ref|YP_005638043.1| gi|21232130|ref|NP_638047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]