SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2QWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2QWZ5
Domain Number 1 Region: 305-382
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.06e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 230-306
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.13e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.76e-34
Family Ubiquitin-related 0.0000304
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.25e-33
Family Ubiquitin-related 0.0000304
Further Details:      
 
Domain Number 5 Region: 152-230
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.93e-32
Family Ubiquitin-related 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2QWZ5
Sequence length 383
Comment (tr|A0A0D2QWZ5|A0A0D2QWZ5_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB62482.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_009G418900 OC=Gossypium.
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
KIQDKEGIPPDQQRLIFAGKQLEDGHGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
TLADYNIQKESTLHLVLRLRGGQ
Download sequence
Identical sequences A0A0D2QWZ5
Gorai.009G418900.1|PACid:26766808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]