SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2RMC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2RMC8
Domain Number 1 Region: 187-250
Classification Level Classification E-value
Superfamily PUG domain-like 1.83e-17
Family PUG domain 0.0033
Further Details:      
 
Domain Number 2 Region: 335-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000465
Family UBX domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2RMC8
Sequence length 474
Comment (tr|A0A0D2RMC8|A0A0D2RMC8_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB30761.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_005G158800 OC=Gossypium.
Sequence
MSEMKDKLKGFMKKVNTQFSSSSSSSGKFKGQGRVLGSSSSSGPVNPILTRPSPIPNPAP
SSSSSNSKPVLPSKPPVSDQNKPSSNSNPEPNHKTGSGFDPYDSFITSSKVSKNGFTLNV
FECPICGASYRSEEEVSIHVETCVNNTNSLDRKGTDDESGSNETALEESRGEVEVRVSSF
LSGKPAEGSIEVVLKLLRNIVKEPGNDKFRKLRMSNPKIREAIGEVAGGVELLEFVGFEL
EEEGGEMWAVMDVPKEEQISVISKAIMLLEPGNMEKFKKSENISPTASPEKEETVESKKI
DRKIRVFFSVPESVAAKIELPDSFYNLSSEELKREAEMRKKKIADSQLLIPKSYKEKQAK
AARRKYRRTIIRIQFPDGVVLQGEFAPWEPTSALYEFVSSALKEPCLEFELLDPVIVKLR
VIPSFPAAGEKGRTLEEEDLVPSALIRFKPVETDSVVFTGLSNELLEISEPLVN
Download sequence
Identical sequences A0A0D2RMC8
XP_012479004.1.20347 XP_012479005.1.20347 Gorai.005G158800.2|PACid:26804591 Gorai.005G158800.3|PACid:26804590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]