SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2RNG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2RNG5
Domain Number 1 Region: 230-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 65-139,195-222
Classification Level Classification E-value
Superfamily POZ domain 7.32e-16
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2RNG5
Sequence length 575
Comment (tr|A0A0D2RNG5|A0A0D2RNG5_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB33389.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_006G009000 OC=Gossypium.
Sequence
MDYGSEISSSLTFPSSSYLSNGSGFGSGSHLMGASSDPEETDLENLSLNKLSGNLENLVI
NEEYENYNDAEIVVEGNVVVSVNRCILAARSPYFHQLFRQDPKDDRKPKYLMSEILPFGK
VGYEAFKVFLQYLYTGKIKASPRDVSTCVDESCSHDACGPLINYALELMYASATFHTKEL
VLLVQRHLLNIVEKALIEDVIPVLVAAFHYQLNQLLSQCFERVAKSDLDNVCLEKELPPE
VYAKIRSLRLVPELVESDLVHEKKIKRIHKALDSDDIELLELLLRESNVTLDEAYALHYA
VAYCDPKIVSEVLCLGLANVYLKDHRGFTALHVAARRKEPSVLVALLNKGASVTETTLDG
RTAVDICRRLTRVKDYNENKKQGAPSNKDRLCIDVLEAKMRCSESENLGVPTQVIAYDLH
MKLDYYENRVSFARLLYPAEAKVAMEIAEADSNISEADLNESPTSHTRRLHLRLQTLFRT
VETGRRYFPHCAEVLDKFLVDDMSDPSFFEDGSSEEQRVKKRRFTELKEELLEAFYKDKA
DQKKHNHRPVLSPSSSSSSSTTKLGSSTPYKPRRK
Download sequence
Identical sequences A0A0D2RNG5
XP_012483470.1.20347 Gorai.006G009000.1|PACid:26832715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]