SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2TA37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2TA37
Domain Number 1 Region: 21-98
Classification Level Classification E-value
Superfamily TSP9-like 3.4e-27
Family TSP9-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2TA37
Sequence length 98
Comment (tr|A0A0D2TA37|A0A0D2TA37_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB53469.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_009G093000 OC=Gossypium.
Sequence
MASLPIFSFVPSKTRIYATAAAKGAGGGKEEKGLFDWILGNLQKEEQFYETDPILKKVEE
KNGGGSGSGTTSGRKNSVSIPQKKKDNGGFGLGGLFKK
Download sequence
Identical sequences A0A0D2TA37
Gorai.009G093000.1|PACid:26768751 XP_012444277.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]