SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2UR55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2UR55
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.92e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 146-230
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.18e-25
Family Middle domain of MutM-like DNA repair proteins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2UR55
Sequence length 464
Comment (tr|A0A0D2UR55|A0A0D2UR55_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB70731.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_011G089400 OC=Gossypium.
Sequence
MPELPEVEAARRAIEENCLGKKIKRAIIANDSKVIEGVSSLDFESALLGKTIVSAHRKGK
NLWLHLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDNDEWPSKYSKFFVELDDGLEL
SFTDKRRFARVRLLKDPTSVPPISELGPDALFEPMTINEFTDSLSKKKIGIKALLLDQSY
ISGIGNWIADEVLYQARIHPLQICSSLSKENCATLHNCIKEVIQYAVEVDADCNRFPCDW
LFHFRWGKKSGKIKGKIPLMKLIIMLKKLFLQVIEKAVEVGADSSQFPSNWIFHSREKKP
GKAFVDGKKIDFINAGGRTSAYVPDLQKLSGTVATKAAGKPRKQASKKKGGDEAEDNDGD
EDGVGDEPTNEEEESTKITKPKKGGNPRGRGKKPPMKRKAKESDDDDDDDSGGNNDVSSE
EDDEDPTEKGRKVKTNTSNKQAKTVKTSKRAVSSQDGKKPKRAK
Download sequence
Identical sequences A0A0D2UR55
XP_012456205.1.20347 Gorai.011G089400.1|PACid:26807973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]