SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2Y078 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2Y078
Domain Number 1 Region: 13-328
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 7.45e-63
Family ADP-ribosylglycohydrolase 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2Y078
Sequence length 333
Comment (tr|A0A0D2Y078|A0A0D2Y078_FUSO4) ADP-ribosylglycohydrolase {ECO:0000313|EMBL:KNB08992.1} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_09666 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MPSSQNKSELSPRESRVIGALLGVHAGDSLGATLEFKTHTDIAREYPLGLREIVGGGPFR
WSQGHATDDTDMTRGVLLAYHDYKAGDDVAHLAGDYFISWLHGDWPGRRPGSRPEDIGGA
TATGLMRYEQTQDPDRAGAGEGSAGNGSLMRCIPTGLFQRDPQKLVEESVRISKITHDDK
RCTVACAAYNTIVSKLIDQVAPQEAIEAGLQVAETLEVGYGPVYQSIELGKSLNIATMAA
KGPVPELGGRCSGYVLESLSLAIAAVLDTRSLEDIVVDVVRIGWDTDTNGAIAGGILGAR
DGAAAIPPQWRSVLQFGREFENTALSIFEKKAA
Download sequence
Identical sequences A0A0D2Y078
XP_018247037.1.49799 FOXG_09666T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]