SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D3CML1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3CML1
Domain Number 1 Region: 24-207,235-394
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.72e-41
Family Glycerol-3-phosphate transporter 0.075
Further Details:      
 
Domain Number 2 Region: 494-675
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 7.85e-30
Family PsbP-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3CML1
Sequence length 677
Comment (tr|A0A0D3CML1|A0A0D3CML1_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo5g145430.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN= OC=Brassica.
Sequence
MEKGLLLTNKEETARTTLLLVFSTFIIVCASFTFGVSAGYTADTMSSIMTDLDLSLAQFS
LFGSLMTFGGMIGAIFSAKAASALGNKMTLWLADLFCITGWVAIALAKDIVLLDLGRFFV
GIGVGLISYVVPVYVAEITPKHIRGAFTFSNQLLQNCGVAIAYYFGNFLSWRSLALIGII
PCGIQVIGLFFIPESPRWLAKKGRDEEVEVVLQRLRGKGHDIMFEARAIKISVEVSKQNS
NTSIRSLFRKRYAHQLTIGIGLMLLQQLCGMSGIGSYGSTLFELGGFSARIGMTVLSLIV
ASAFGLCLSCITLAVAFGVKDVPEIQNITPVFTFIGILSFTMMFAFGMGALPWVIMSEIF
PMDIKVLAGSLVTIANWFTGWIANYCFNFMLVWSPAEMSLKLYFSLHSSSLKSAKPSSIL
IAQQSPGDRKTSPADEFSPLAEKFNRRLLLGIGSSSVLAIGANFGGVTSFVLGLSPEFGR
NLQLDVVYPIRGYSRCIDTVEGFEFIYPATWVGDQTLLYRAAEKTERETSLDLPPARISR
RKNVNEPVVAFGPPGSTGELNVSVIVSPVSPTFSIEAFGGPKEVGEAIVKTVTRSGQRTD
LKGTLLEANLRQDSERNLKYYELEFKVESPSFRRHNVAVCCANGGRLYTLNAQAPESAWS
ELKHEFHTIAKSFNIIS
Download sequence
Identical sequences A0A0D3CML1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]