SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RB86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RB86
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-581
Classification Level Classification E-value
Superfamily Moesin tail domain 4.97e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RB86
Sequence length 590
Comment (tr|A0A0D9RB86|A0A0D9RB86_CHLSB) Neurofibromin 2 {ECO:0000313|Ensembl:ENSCSAP00000005875} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=NF2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences A0A024R1J9 A0A0D9RB86 A0A2I2ZFQ4 A0A2K5P4Z6 A0A2K5WC53 A0A2K5XBL4 A0A2K6NI50 F6RPW5
gi|32451486|ref|NP_057502.2| gi|32967254|ref|NP_861546.1| gi|32967266|ref|NP_861970.1| NP_057502.2.87134 NP_057502.2.92137 NP_861546.1.87134 NP_861546.1.92137 NP_861970.1.87134 NP_861970.1.92137 XP_005567710.1.63531 XP_007973535.1.81039 XP_007973536.1.81039 XP_010357716.1.97406 XP_010357721.1.97406 XP_011851093.1.47321 XP_011851094.1.47321 XP_011893159.1.92194 XP_015005486.1.72884 XP_015005487.1.72884 XP_018874186.1.27298 XP_018874187.1.27298 ENSP00000354529 ENSP00000380891 ENSP00000384797 ENSP00000354529 ENSP00000380891 ENSP00000384797 ENSMMUP00000037118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]