SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9RLD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RLD6
Domain Number 1 Region: 319-603
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-62
Family Kelch motif 0.0000754
Further Details:      
 
Domain Number 2 Region: 55-167
Classification Level Classification E-value
Superfamily POZ domain 1.02e-30
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RLD6
Sequence length 621
Comment (tr|A0A0D9RLD6|A0A0D9RLD6_CHLSB) Kelch like family member 6 {ECO:0000313|Ensembl:ENSCSAP00000009425} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=KLHL6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MLMAGQRGAWTMGDVVEKSLEGPLAPSTDEPSQKRGDLVEILNGEKVKFDDAGLSLILQN
GLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDA
ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRL
ADTHSLDSLKKQVQSYIIQNFVQILNSEEFLDLPVDTLHHILKSDDLYVTEEAQVFETVM
SWVRHKPSERLCLLPYVLENVRLPLLDPWYFVETVEADPLIRQCPEVFPLLQEARMYHLS
GNEIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPLTEHEL
ESENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLG
GKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGK
LATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCL
VTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHG
SVTIRKSYTHIRRIVPGAVSV
Download sequence
Identical sequences A0A096MNW3 A0A0D9RLD6 A0A2K5LYN8 A0A2K5ZWI3
ENSPANP00000001387 XP_007970162.1.81039 XP_011841536.1.47321 XP_011889912.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]