SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9RLF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RLF3
Domain Number 1 Region: 1006-1137,1200-1266
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.05e-38
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000222
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000017
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RLF3
Sequence length 1266
Comment (tr|A0A0D9RLF3|A0A0D9RLF3_CHLSB) Proteoglycan 4 {ECO:0000313|Ensembl:ENSCSAP00000009442} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=PRG4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSAKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEGKDNKKNRTKKKPTPKPPVVDEAG
SGLDNGDFKVTTTPATSTTQHNKVTTSPKITTAKPKNPRPSLPPNSDTSKQTSLTTNKET
TVETKEPTTTNKQTSTDGKETTSAKETQSVEKTSAKDLAPTSKVPAKPTPKAETTTKGPA
LTTPKEPTPTTPKEPASTTPKEPAPTTTKSGPTTPKEPAPTTPKEPAPTTPKKPAPIAPK
EPSPTTTKKPAPTTPKEPSPTTTKEPAPTIPKEPAPTTPKEPAPTTTKEPASTTPKEPSP
TTTKEPAPTTPKEPSPTTPKKLTPTTPKEPAPTPPKEPAPTTPKEPAPTPPKEPAPTTPK
EPAPTTPKEPAPTTPKEPAPTTTKKPVPTTPKELTPTIPEELVPTTPEELTPTTPEEPAP
TTPAELAPTTPEEPAPTTPKAPAPTTPKEPAPKTAPTTPKEPAPTTPKGTAPTTPKGTAP
TTLKETAPTTPKGTAPTTPKGTAPTTLKETAPTTPKGTAPTTLNEPAPTTPKQPAPKELI
PTTTKEPTPTTSDKPAPTTPKEPAPTTPKKPAPTTPETPPATTSEASTPTTTMEPPTSHK
SSDESTPELSAEPTPKVLENSPKKPSVPTTKTPAVTKSEMTTIAKDKITERDIRTTPETT
TVAPKMTKETATTTEKTTESKITTTTTQVTSTTTQDTTPFKITTFKTTTLAPKVTTTTKK
TITTTEIMNKPEETAKPKDRVTNSKVTTAKPQKPTKAPKKPTSTKKPTSTKKPTSTKKPK
TTPRVRKPKTTPTPPKMTSTMPELNPTSRVAEAMLQTTTRPNQTPNSKLVEVNPKNEDAG
GAEGETPHMLPRPHVFTPIVIPGMDYSLRVPNQGIIINPMLSDETDICNGRPVDGLTTLR
NGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWR
FTNDIKDAGYPKPIIKGFGGLTGQIVAALSIAKYKNRPESVYFFKRGGSIQQYIYKQEPV
QKCPGRRPALNYPVYGETTQVRRRRFERAIGPSLTHTIRIHYSPVRLAYQDKGFLHNEVK
VSTLWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSK
VWYNCP
Download sequence
Identical sequences A0A0D9RLF3
XP_007987342.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]