SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0BIV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0BIV2
Domain Number 1 Region: 96-171
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.97e-33
Family Skp1 dimerisation domain-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily POZ domain 3.66e-23
Family BTB/POZ domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0BIV2
Sequence length 173
Comment (tr|A0A0E0BIV2|A0A0E0BIV2_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM11G12440.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAEGEKKMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVI
EYCNKHVHAAAAAASKAADDAASAAAAVPPPSGEDLKNWDADFVKVDQATLFDLILAANY
LNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEIRRENQWAFE
Download sequence
Identical sequences A0A0D3HLJ8 A0A0E0BIV2 A0A0E0F5G6 A0A0E0J1P5 A0A0E0R830 A2ZDZ0 I1QZZ8 Q6PL11
ORGLA11G0109000.1 XP_015617535.1.37577 OsIBCD032705 OBART11G12680.1 39946.BGIOSIBCE034366 OMERI11G10230.1 LOC_Os11g26910.1|PACid:21944824 OGLUM11G12440.1 ONIVA11G12450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]