SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0PE09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0PE09
Domain Number 1 Region: 505-715
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000036
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 256-514
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000019
Family Tropomyosin 0.0056
Further Details:      
 
Domain Number 3 Region: 1247-1472
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000501
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number 4 Region: 1026-1260
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000736
Family Tropomyosin 0.0053
Further Details:      
 
Weak hits

Sequence:  A0A0E0PE09
Domain Number - Region: 790-1056
Classification Level Classification E-value
Superfamily Tropomyosin 0.00019
Family Tropomyosin 0.00035
Further Details:      
 
Domain Number - Region: 103-302
Classification Level Classification E-value
Superfamily Tropomyosin 0.0497
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0PE09
Sequence length 1849
Comment (tr|A0A0E0PE09|A0A0E0PE09_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI04G26850.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MEVEQAAEVGEVTAPKLPDKAVDKAQVHDDDKENLVNGNSNLQVKEAHNDEDDGTGSDGF
ELIDVKENFDSAKVVEEEKASPIEQGKTAALEEQALMRESAMLNQETKQLEELTRRIEEL
ELEKEKLVKGVTEAENKQNLHYTSLQEAQRSLADKDKELADATQSLKELGSELESSKERI
QEIEAELAASADKLHKLEELKDERSLHAAQEAKRASELDKTLETAQLNMKEMEAQISSLQ
EEIKGHQDKAIDHQQVEESLRSTLSELKMVQEALELSKSQVDDLEQKLASQDANISHLTE
ELSLHRSSEESLKEKTLKLENELSSAHEELQAKILNLQEMEIKLEEQAKEKQTWEATLEK
QQEQILNLQTELDESKGGNETLRGTIADLNSKLAERDSLLRQAEDEHAKAQLLLSEALSH
KDELEVNLKSINEQHGESRAAAENASQKILELEALLQTLHATEEALKLQLEEAEARVEVA
EKKGSDLEQLLGESENKLVASSGELKLLEERVQQEAASSAEKEKLLEEATNSVEAYKEKI
NELQASLDSTTSKNQLLEQEVKDLSDKFTEHQEQAHSVHERSLELESLLHTSKSDAEVAH
TRTQDLENELNTANEKFKEVEADLEQYRSKVSQLSDELEAYQTKAASLEAVMESASEKEK
ELVESLGQITEEKKKLELLVLEYEEKTEEYLKEKQSLEERLQSQESKVLALEESLVKMGE
EKESHEGTIADLNLQLSNKNDMYMQLESQLSQAGDDHSKTRSLLSEAQLHKEELELNLKS
LNDLHVESKTAAESALQRIAELETQVQELSAAEQSLKSHLTEFESKLASAEKKSMDLEQE
LKDATEECNSSRLRVDELSGELEEYKEKRTSLEASLLEAKQKEAELSEKLDQVNEEKEKF
EELSKKATIKHLEAENQVQALQGELESARHKLEEVESDLEALGIRETSVLDKLKSAEEQL
EHKGKALEHATSKKIDLEALYQSLLEDTEMKLQQAGENLTQKETECQELSEKLKAAEEQA
ASYQAKATAAAEEVESVKVELEAFETEISTLETTIEELKTKASNAESRAEQALVESAMMS
ETNQALKEDLDAKLAMLRELQEQFDSTHAEKEEVFTKLSAHEKTIEHLTEVHSRGLELHA
TAESKNAELEAQMHEALETIGKKDSEVKDLNERLAALESEIESLTHVNEAMKQEINAKLV
KVDELQEKLSSISSEKEEVAEKVVVHEKTIEHLREEHSRGLELQSAAESRSAEIENELRE
VLETVAQKEAEVTDLKEKLVSLETENEKLVGINEALKGELDTKVAMFDELQEQFSSTHAE
KEEAAEKLAVHERTISHLTEVHTRSLELHSAAESKNEEIESKLHEALEMAAQKEAEVKDL
SKKLDALEIELGYYEEQATEAAAAEETHKIKFDEAVHKIKSLEEQLAVTENKVELFHTEK
ENLVIANSKLNEELELHQNKLNELQVALAAAVAEKEGSSEEIHSLRKTLDGMIQRKEELE
SQVSSTVEEHEELKSKYNITLEEKQLLNEKYESAKKELGEAIAKLEEQMNVDKSEKELHI
SKLERQITLSELKYMEEIQTMQVETTEKDEALTTKMQEHANLVHEKDALEQQLLEVRKEL
NDAYHTIANQEEQVSVREIKWDAYKKFSEDQLEAEQQHVAELEVQVSSLKQQLQEAEIHY
KHKEEQVSLREVQWEADQEHSVSELKAQRQYAAELEKQIGALTQQLQLVEKQYEQKVTEE
REKLALVNTEVSKLTQKLSKSAEMEKKIEHLEQKLQAKDSVESTSRDFSLDSSTLPSKQR
DRSLAPETTPPNPTQQQELREPSGIMAFKFILGVALLSVLIGVFLGKRY
Download sequence
Identical sequences A0A0E0H5X6 A0A0E0PE09
ONIVA04G24290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]