SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E1WGD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E1WGD8
Domain Number 1 Region: 20-291
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.89e-94
Family Methylenetetrahydrofolate reductase 0.00000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E1WGD8
Sequence length 292
Comment (tr|A0A0E1WGD8|A0A0E1WGD8_HAEIF) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome OX=656913 OS=Haemophilus influenzae NT127. GN=HIAG_01485 OC=Pasteurellaceae; Haemophilus.
Sequence
MSYAKEIDTLNQHIADFNKKINVSFEFFPPKNEKMETLLWDSIHRLKVLKPKFVSVTYGA
NSGERDRTHGIVKAIKQETGLEAAPHLTGIDATPEELKQIARDYWDSGIRRIVALRGDEP
KGYAKKPFYASDLVELLRSVADFDISVAAYPEVHPEAKSAQADLINLKRKIDSGANHVIT
QFFFDIENYLRFRDRCASIGIDTEIVPGILPVTNFKQLQKMASFTNVKIPAWLVKAYDGL
DDDPTTRNLVAASVAMDMVKILSREGVNDFHFYTLNRSELTYAICHMLGVRP
Download sequence
Identical sequences A0A0D0II49 A0A0E1WGD8
374930.CGSHiEE_04820 gi|148825987|ref|YP_001290740.1| gi|386265891|ref|YP_005829383.1| WP_005662370.1.23065 WP_005662370.1.25413 WP_005662370.1.26667 WP_005662370.1.32414 WP_005662370.1.3733 WP_005662370.1.40038 WP_005662370.1.51509 WP_005662370.1.55069 WP_005662370.1.56181 WP_005662370.1.61426 WP_005662370.1.68713 WP_005662370.1.76410 WP_005662370.1.76422 WP_005662370.1.80605 WP_005662370.1.91647 WP_005662370.1.98200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]