SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E2TDQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2TDQ4
Domain Number 1 Region: 7-357
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-73
Family TK-like PP module 0.025
Further Details:      
 
Domain Number 2 Region: 302-486
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-55
Family TK-like Pyr module 0.02
Further Details:      
 
Domain Number 3 Region: 499-631
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.05e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E2TDQ4
Sequence length 648
Comment (tr|A0A0E2TDQ4|A0A0E2TDQ4_BACFG) 1-deoxyxylulose-5-phosphate synthase {ECO:0000256|HAMAP-Rule:MF_00315} KW=Complete proteome OX=1339310 OS=Bacteroides fragilis str. 3783N1-6. GN=M119_0971 OC=Bacteroides.
Sequence
MKNEPTYSLLNAINYPKDLRQLSVDQLPEVCEELRQDIIKELSCNPGHFAASLGVVELTV
ALHYVYNTPYDRIVWDVGHQAYGHKILTGRREAFSTNRKLGGIRPFPSPEESEYDTFTCG
HASNSISAALGMAVAAERKGEKDRHVVAVIGDGSMSGGLAFEGLNNASSTANNLLIILND
NDMAIDRSVGGMKQYLFNLTTSNRYNQLRFKTSRLLFKMGLLNEERRKALIRLGNSLKSL
AAQQQNIFEGMNIRYFGPIDGHDVKNIARILHDIKDMQGPKILHLHTIKGKGFGPAEKQA
TIWHAPGKFDPVTGKRIVANTDGMPPLFQDVFGHTLVELAEKNKRIMGVTPAMPSGCSMN
MLMDRMPDRAFDVGIAEGHAVTFSGGMAKDGLLPFCNIYSSFMQRAYDNIIHDVAIQKLN
VVFCLDRAGLVGEDGPTHHGVFDMAYLRPIPNLTISSPMDEHELRRLMYTAQLPDKGPFA
IRYPRGRGSLVDWECPLEEIPVGKGRKLKDGNDLAVITIGPIGKLAARAIERAEADTGIS
VAHYDLRFLKPLDEELLHEVGKKFRHIVTIEDGIIKGGMGCAILEFMADNGYYPEIRRIG
VPDQFIEHGSVQQLYHLCGMDEEGIYKVITKNKLRMDAPVESCMATHS
Download sequence
Identical sequences A0A0E2TDQ4 Q5LH44 Q64Y02
272559.BF0796 295405.BF0873 gi|60680350|ref|YP_210494.1| WP_010992199.1.21713 WP_010992199.1.22050 WP_010992199.1.26832 WP_010992199.1.37988 WP_010992199.1.51373 WP_010992199.1.54019 WP_010992199.1.58084 WP_010992199.1.6251 WP_010992199.1.76253 WP_010992199.1.95750 YP_098158.1.45732 gi|53712166|ref|YP_098158.1| BfR94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]