SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3PT39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3PT39
Domain Number 1 Region: 682-972
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.4e-45
Family Quinoprotein alcohol dehydrogenase-like 0.001
Further Details:      
 
Domain Number 2 Region: 976-1056
Classification Level Classification E-value
Superfamily PKD domain 1.07e-31
Family PKD domain 0.0003
Further Details:      
 
Domain Number 3 Region: 12-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-31
Family Pectin methylesterase 0.037
Further Details:      
 
Domain Number 4 Region: 335-420
Classification Level Classification E-value
Superfamily PKD domain 1.31e-24
Family PKD domain 0.0005
Further Details:      
 
Domain Number 5 Region: 425-508
Classification Level Classification E-value
Superfamily PKD domain 8.11e-23
Family PKD domain 0.00037
Further Details:      
 
Domain Number 6 Region: 512-597
Classification Level Classification E-value
Superfamily PKD domain 8.24e-23
Family PKD domain 0.00029
Further Details:      
 
Domain Number 7 Region: 601-709
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000463
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3PT39
Sequence length 1269
Comment (tr|A0A0E3PT39|A0A0E3PT39_9EURY) Cell surface protein {ECO:0000313|EMBL:AKB38587.1} KW=Complete proteome OX=1434118 OS=Methanosarcina siciliae C2J. GN=MSSAC_3997 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKKIHYVCMVALLSTMMLAVAPASATTWDVSTVSELQNAAANAGEGDTIFVHNGNYTLTS
TLYLYKSNITFTGESKEGVVLLRDNDFITIGSNDGPAPGCVVENMTLLGDITSTSGVFGI
SVRSPDCTLRNLILRDIRDCAVISSNSEDCSGLIISNCTFDNSGTENFAISILATNSIIE
NNVIKNNQYAYGPLCVQAQNVTVSNNLFMNNPYAFYLYQADNSLVSGNNMVSSGNILIYD
PGENIVWQLNNFSESIVSNEWAGPLPSATYWNSTEPVEYTYNGSTYNGYPGNYWGAAYTG
TDADGDGIGDTPYEVPDSLGTDYSPLISPKENYEILEPPVANFNAVPLSGNVPLAVRFTD
QSTGSGISGRAWDFDGDGNVDSTEQNPSHTYNSTGAYTVSLTVTGQLGSDSKTKADYINV
KEPAEPPIADFSAEPLSGPVPLEVRFTDLSTGEGIDSWSWDFDSDGTVDSTEQNPIFTYS
ETGNYTVTLNVTGTGGSDSKVKADYIVSEEAEPAFPTAGFSASARDGAVPFTVKFTDSSE
NTIDWAWDFDGDGNVDSTEQNPLYTYYTEGNYTVKLTASNGNGSDVLEIPDMIKVAPERP
APPEDSWYQFHGKVNHLGYSENGPKTNRTEWISEGVTDAIGSSSPVVAEGKVFVICGGAG
MGEETTGVVQLVALNESTGDITWNVSIPETVYGSWASPAYDDGMVFTATGPELGCYNAET
GEKIWCFNDTVGTLGAVNGGPAIADGMVIFSDWDGHHYYCLDEYTGYLLWSFVVVGDAQS
VPAYADGKFYLTGWTYTQGYAYCVDATTGEQLWNINVERSFCGSPAYKDGVLYLTTYNFY
GDGDLFALNATDGSIIWQQTVQRTDSTPALAYGNVYVSGGCSGFSNVQTYCFNATTGTPV
WSTPSKTGDDGGIGDWTWSVAVADGLAYVGGYALDAFTGDVIWNSPYGGGTPALSDGMLF
SIGSNKKIYAFKDSLSSPVANFTATPTAGDAPLTVNFTDQSTGTPTSWLWDFGDGANSTE
QNPSHTYTSAGNYTVNLTVENATGMDFELKSDYIEVSEVSGSTVTLYFDPESFSVSENES
TEINLVASNFPAGLSGYNLTVAIDDPAVAEIVDIEYPSWALITENSTLPGTSIYLKAVDG
EDTVQAGAADAVLATLTVSGKEKGSANLSIEVDRLDDDSGNVIEPALFAGKIEVTLLSPL
PDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYLDFNGNGRIDFD
DVVDMFAMI
Download sequence
Identical sequences A0A0E3PT39
WP_048185006.1.11460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]