SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3RH38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3RH38
Domain Number 1 Region: 8-460
Classification Level Classification E-value
Superfamily L-aspartase-like 3.14e-123
Family L-aspartase/fumarase 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E3RH38
Sequence length 491
Comment (tr|A0A0E3RH38|A0A0E3RH38_METMZ) Arginosuccinase {ECO:0000256|HAMAP-Rule:MF_00006} KW=Complete proteome OX=213585 OS=Methanosarcina mazei S-6. GN=MSMAS_2394 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MSNILRRGRLEAAQDEEILRYTSSMEADRWIFNADIVVDLAHTVMLREQGIIKEEDCSKI
LSGLLKIREEGMEKLDFSYEDIHISLESRLIDMVGEDVGGRMHSGRSRNDEVATCIRLTL
REELLGLLEEIFALRKTLVSLAEKHSETLMPGFTHLQHAQPTTLAHHLCAHESALGRDFD
RVQDAFSRVNLCPLGAAAFASTGFNLNRKRTQELLGFEGLLENSMDAVSSRDFLIECASV
FSNLMINLSRIAEELVIWSSSEFNFIELDDMYASTSSIMPQKKNPDTAELMRGKTGVSVG
ALMSLLTICKGLPLSYNRDLQEATPNIWRSVETVRASVRVMEGMVKTMKVHPDVLAAESI
TGFTTATELADTFVRETGIPFRTAHQIVGMLAKEREKPTMEKIDSASEVVLGESLSSKGL
TENMVKEALNPESNIKRRKIPGGPAPEEMKNYLSKRKTELELNAQEIATLKDIIDSAFEN
LLSVVEEYRKI
Download sequence
Identical sequences A0A0E3RH38 Q8PUM6
192952.MM_2307 WP_011034231.1.49674 WP_011034231.1.90340 gi|21228409|ref|NP_634331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]