SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E3ZTV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3ZTV7
Domain Number 1 Region: 11-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.67e-56
Family Methylesterase CheB, C-terminal domain 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3ZTV7
Sequence length 351
Comment (tr|A0A0E3ZTV7|A0A0E3ZTV7_9BACT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1379870 OS=Spirosoma radiotolerans. GN=SD10_03330 OC=Spirosoma.
Sequence
MEKSTQKTVKRDIVIIGSSAGGLPALMEIVAALPPNFPAAILIVQHIPPYSVSNLHQILN
RLGPLPATIAKDGELIEPGKIYVASPDHHLLVEDGKIGVKRGPKENRFRPSVDALFRSAA
YTYGSRVIGIVLSGVLDDGTSGLWSVKRLGGLTMIQQPEDALFPQMPLNVQEQVEVDHSL
PASQMAALLAQLTAEPTRPTIKLTKRELKLLEMEIVIAGKDNAFEMGIIDMGELTPFTCP
ECHGALTQLKEGNIIRFRCHTGHAYTISALLSEVTTNVEAILWQAMQGLEETTMLLTRLG
QHFEKLNHDEVAQVFFQKSKLIKDRSQVVHDSVFSQELLSGDIGLKIQADV
Download sequence
Identical sequences A0A0E3ZTV7
WP_046375671.1.5798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]