SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E9K790 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E9K790
Domain Number - Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0405
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9K790
Sequence length 151
Comment (tr|A0A0E9K790|A0A0E9K790_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:GAN48328.1} KW=Complete proteome OX=1604132 OS=Methylobacterium sp. ME121. GN=ME121_2344 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MTIASLAGTFEALGAAWSWVIAGLVLAGAEILLPGVFLIWLGLAAVATGLAAAALPMPWQ
GQTLLFAGLAVALVALATRLQRRGKGTGPELNRADRGLIGREGVLDEPIVRGAGRIRFDD
TLWRVEGPDLPAGRRVRVTGIGGTVLRVEAA
Download sequence
Identical sequences A0A0E9K790 A0A154NCS8 B1LV61
gi|170751490|ref|YP_001757750.1| WP_012322014.1.25698 WP_012322014.1.31760 WP_012322014.1.35747 WP_012322014.1.5195 WP_012322014.1.89921 426355.Mrad2831_5110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]