SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E9ZLP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9ZLP6
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.1e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000306
Further Details:      
 
Domain Number 2 Region: 281-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 8.72e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9ZLP6
Sequence length 403
Comment (tr|A0A0E9ZLP6|A0A0E9ZLP6_9PSED) Cytochrome b {ECO:0000256|RuleBase:RU003385} KW=Complete proteome OX=1546029 OS=Pseudomonas sp. 10-1B. GN=TZ03_14205 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSKFMDWIDARFPATKMWEDHLSKYYAPKNFNFLYFFGSLALLVLVNQIVTGVWLTMSFT
PSAEEAFASVEYIMRDVEYGWILRYLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWL
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKKKDENGIPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVRSMRYKGWISKVFLLVFCVAFVILGVLGV
LAPTPGRTLLSQVCTVLYFAYFLLMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A0E9ZLP6 A0A0P7D2T3 A0A132GE35 A0A161IRE2 A0A173HAP9 A0A177JSE4 A0A2I0CJL4 A0A2K4L832
gi|512683885|ref|YP_008111865.1| WP_003251825.1.100978 WP_003251825.1.1079 WP_003251825.1.1090 WP_003251825.1.11138 WP_003251825.1.13892 WP_003251825.1.17434 WP_003251825.1.18387 WP_003251825.1.19681 WP_003251825.1.25319 WP_003251825.1.33269 WP_003251825.1.33725 WP_003251825.1.35996 WP_003251825.1.42506 WP_003251825.1.43930 WP_003251825.1.44137 WP_003251825.1.45427 WP_003251825.1.54338 WP_003251825.1.54657 WP_003251825.1.5613 WP_003251825.1.59535 WP_003251825.1.60844 WP_003251825.1.62279 WP_003251825.1.62816 WP_003251825.1.62999 WP_003251825.1.65173 WP_003251825.1.65540 WP_003251825.1.66485 WP_003251825.1.66713 WP_003251825.1.66754 WP_003251825.1.67665 WP_003251825.1.71479 WP_003251825.1.71624 WP_003251825.1.74642 WP_003251825.1.75010 WP_003251825.1.75189 WP_003251825.1.76632 WP_003251825.1.7826 WP_003251825.1.78345 WP_003251825.1.81634 WP_003251825.1.87386 WP_003251825.1.89748 WP_003251825.1.93113 WP_003251825.1.95600 WP_003251825.1.96571 WP_003251825.1.96951 WP_003251825.1.98215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]