SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2BLK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2BLK2
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily Ribosomal protein S7 4.06e-59
Family Ribosomal protein S7 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2BLK2
Sequence length 155
Comment (tr|A0A0F2BLK2|A0A0F2BLK2_MYCMY) 30S ribosomal protein S7 {ECO:0000256|HAMAP-Rule:MF_00480} KW=Complete proteome OX=2103 OS=Mycoplasma mycoides subsp. mycoides. GN=MSCT144_10990 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MRKNRAEKRDVLADPIYNSKLVTRAINKIMLDGKRGIAQSIIYDAFNIIKEKTNKEPIEV
FNKAIENIKPHLELKVRRIGGANYQVPIEVSAERQITLALRWLINYARLRNEKVMTIKLA
NEIIDASNNIGGSVKKREDTHKMAEANKAFAHYRW
Download sequence
Identical sequences A0A0F2BLK2 Q8VMU1
gi|479184382|ref|YP_007810957.1| 272632.MSC_0158 gi|42560710|ref|NP_975161.1| NP_975161.1.55851 WP_011166360.1.11018 WP_011166360.1.17500 WP_011166360.1.32010 WP_011166360.1.3214 WP_011166360.1.37196 WP_011166360.1.51345 WP_011166360.1.72634 WP_011166360.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]