SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F2BNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2BNM5
Domain Number 1 Region: 6-250
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00000000000000201
Family Sir2 family of transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2BNM5
Sequence length 285
Comment (tr|A0A0F2BNM5|A0A0F2BNM5_MYCMY) Uncharacterized protein {ECO:0000313|EMBL:AMK56588.1} KW=Complete proteome OX=2103 OS=Mycoplasma mycoides subsp. mycoides. GN=MSCT144_06920 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MNANLNIDQLDNLINQNDSLIIAIGSEIYQTDNQIEFENNFSDFIKEFNFIDFKQASVYP
FLDIKNYWAFFSRYIKLNYFDQKLDNSFIDLKNYLENKNYFIITTNRDNSLELAGFDLNK
IFYLDSKLNLLECSKKCSEELYINDDAILNMANNQKNLKVELEQIPVCKKCNSYLKVHQR
FWCQVFIKDDEFLQTQNNYQKFINQNKDKKMLFWEIGINFNNQLTVKKPFWQMIEKFDKA
TYLTMNKKIYRIPLEIRSKTITYTNDLNLVIKNLEEVKNGTNRTN
Download sequence
Identical sequences A0A0F2BNM5 Q6MT82
NP_975512.1.55851 WP_011166710.1.11018 WP_011166710.1.17500 WP_011166710.1.32010 WP_011166710.1.3214 WP_011166710.1.37196 WP_011166710.1.51345 WP_011166710.1.72634 WP_011166710.1.84266 272632.MSC_0528 gi|479183784|ref|YP_007811349.1| gi|42561061|ref|NP_975512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]