SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F3QMM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3QMM7
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000000209
Family TTHA1013-like 0.051
Further Details:      
 
Domain Number 2 Region: 72-112
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000586
Family Omega transcriptional repressor 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QMM7
Sequence length 114
Comment (tr|A0A0F3QMM7|A0A0F3QMM7_RICPA) Uncharacterized protein {ECO:0000313|EMBL:KJV93401.1} KW=Complete proteome OX=1359203 OS=Rickettsia parkeri str. Grand Bay. GN=RPAGB_0488 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MKTNDTFDGFTIELFKDTDGDWLARFEELPNVSAFGNSPEKALQELQQAWTLMKASYISH
NQSIPLAPSRKEYSGQFNVRVDKRVHRALVLEALRAKISLNALVSQKLTLSVKQ
Download sequence
Identical sequences A0A0F3QMM7
gi|383484390|ref|YP_005393303.1| WP_014410990.1.24793 WP_014410990.1.3533 WP_014410990.1.42246 WP_014410990.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]