SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3QN33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3QN33
Domain Number 1 Region: 54-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.76e-28
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QN33
Sequence length 198
Comment (tr|A0A0F3QN33|A0A0F3QN33_RICPA) SCO1/SenC family protein {ECO:0000313|EMBL:KJV93978.1} KW=Complete proteome OX=1359203 OS=Rickettsia parkeri str. Grand Bay. GN=RPAGB_0109 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MRNNKNQMYIIKIFIALAMITGIIFLCLLYSSLTPSKLKIGAKTSNMDDSPKIKFTLIDQ
EGKKFDSIHLQGHLSLIYFGTTYSLYDNQTLKRVEDIIKILKKENILVQVVFITLDSEHD
TSEVLKKYLEKIDDNFIGLTGRVQDIEQLADQFKVFYTSKIFDVKTNKYELQHSNFVYLI
SSQGKFLKHYYLGLPKNG
Download sequence
Identical sequences A0A0F3QN33
gi|383483392|ref|YP_005392305.1| WP_014410287.1.24793 WP_014410287.1.3533 WP_014410287.1.42246 WP_014410287.1.49683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]