SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F3QQF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3QQF9
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.35e-34
Family Transcriptional regulator Rrf2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QQF9
Sequence length 142
Comment (tr|A0A0F3QQF9|A0A0F3QQF9_RICPA) HTH-type transcriptional repressor nsrR {ECO:0000313|EMBL:KJV93669.1} KW=Complete proteome OX=1359203 OS=Rickettsia parkeri str. Grand Bay. GN=RPAGB_0758 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MQLTSFTDYGLRSLIYLASKPERICSVKEISEYHNISLNHLIKVIHRLAQLGYINSSKGK
GGGIKLAFSPSSMKLGDIIEKLEPNMDIVECFNKNTNSCKITNSCQFKHFIKEASEAFIK
TLNNYTLEDAMITKTIQIKDKL
Download sequence
Identical sequences A0A0F3QQF9 C3PNX5
gi|383484156|ref|YP_005393069.1| gi|229586877|ref|YP_002845378.1| WP_012719828.1.22823 WP_012719828.1.24793 WP_012719828.1.29537 WP_012719828.1.3533 WP_012719828.1.42246 WP_012719828.1.49683 347255.RAF_ORF0748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]