SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F4KD69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4KD69
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-77
Family Protein kinases, catalytic subunit 0.0000000309
Further Details:      
 
Domain Number 2 Region: 446-505
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000288
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 513-572
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000733
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F4KD69
Sequence length 675
Comment (tr|A0A0F4KD69|A0A0F4KD69_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:KJY43953.1} KW=Complete proteome; Reference proteome OX=1609106 OS=Streptomyces sp. NRRL B-1568. GN=VR41_00805 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRVDLARDPSFQARFRREA
QSAASLNHPSIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTI
GVLQALEYSHRAGIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFIGDSPVAVAYQHVREEPNPPSTHD
PEIRPEVDAIVLKALTKDPDYRYQSADEMRADIEAALEGRPVAAAASLGAAGYGEDQPTT
MLHAQDAGAAGQTSMMPPVSDGGGYGGYDNGSGGGRRGGGGKKSNLSTILLVVAGILVLV
GAIFIGKSLFSGGGANSEVTVPNLKGETLASAQKLGVNGDFKVVQGGTKPCDEPKGKICD
QDPGQGAKVKSGSEVKVVVSEGEEKIAVPDVRGMKFEEASSQLEDKGFTVKQKQQESDQT
PGVVISQDPAADSKAPKGTEITLTVATKAASKTVPSVVGQTFDAANKQLTDNGFQVVRED
EDSDKPVGTVTRQSPDGNTSAKPGSTVTLFVSKGAAQKGVPSLMGTKLKDAKKALTDAGL
KPGNINGPQDDNAVVVTSDPAQGQQVPQGTAVNLTTMAGLPGGDTGGQPGTGAGQTGGQQ
DIGGLFGGMPGGRKH
Download sequence
Identical sequences A0A0F4KD69
WP_045932050.1.101771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]