SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F4NJQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F4NJQ0
Domain Number 1 Region: 182-367
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.11e-63
Family Methylesterase CheB, C-terminal domain 0.0000093
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily CheY-like 1.42e-26
Family CheY-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F4NJQ0
Sequence length 373
Comment (tr|A0A0F4NJQ0|A0A0F4NJQ0_9VIBR) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=579748 OS=Vibrio galatheae. GN=TW81_08655 OC=Vibrionaceae; Vibrio.
Sequence
MAIKVLVVDDSSFFRRRVSEIINSEARLEVIDVATNGKEAVDKALRLKPDVITMDIEMPV
MDGITAVREIMAKSPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVIQIASRRAMMRRSIPTPLASTRTAPQSTATRSSLRSAPAAPAVKPSIATRFKAS
GKKYQLTAIGTSTGGPVALQKILTKLPANYPHPIVLIQHMPATFTAAFASRLNSLCKIQV
KEAEDGDALKPGVAYLAPGGKQMMIEGRPGSAKLRIIDGGERMNYKPCVDVTFGSAAKIY
SDQVLSMVLTGMGADGREGARMLKSAGSTIWAQDEESCVVYGMPQAVAKAGISTEDLPLD
RIAERMLVEVGLA
Download sequence
Identical sequences A0A0F4NJQ0
WP_045955314.1.42785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]