SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6A4W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6A4W2
Domain Number 1 Region: 117-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-61
Family Pancreatic carboxypeptidases 0.023
Further Details:      
 
Domain Number 2 Region: 659-739
Classification Level Classification E-value
Superfamily PKD domain 0.0000000157
Family PKD domain 0.013
Further Details:      
 
Domain Number 3 Region: 572-648
Classification Level Classification E-value
Superfamily PKD domain 0.0000000641
Family PKD domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6A4W2
Sequence length 740
Comment (tr|A0A0F6A4W2|A0A0F6A4W2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KKE81212.1} KW=Complete proteome; Reference proteome OX=1129367 OS=Pseudoalteromonas luteoviolacea S4054. GN=N479_23305 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MLKKLITTSMLLALGSVTLPLYAHTSSTNGVSSLQRIHKDYSLYFANEEQRVEYAQRYHG
QIINTLHNALIVSLSEKEFLSARASGAVILEHGPALPVNRAANALVKTSQSTLTATQTTG
IPNFPCYPTLEETHEIAEQLAKKYPNFVELKHIGQSWKKEQGIGGHDLTVLVIKNKKRNK
NKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKRWRKNTNTAYCATNEEQIGADLNRNFDFGWNSTPNSSDEQCANTYQGPVAAS
EPETQVIQNYINSIFEDNRGELDTDAAPLDTAGLFLDMHSYGGMIMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYEAHQVGSRFHVGGSADGYAYGHLGVASFTYELGKEFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
YSSYAPLPPSQAVKNVKLIIKKQGEGVVQRLKLPAADGIYDSSREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNQAPVADFTPTCTYGTCHLDASKSTDDKP
GLKYRWFIGSETSREEYSGEKIEYVHEMAGTYYVSLVVEDANDISAVKHAVLDLDGRYLP
IPNFTYQCSGLTCEFDSSSASDPDGHIVERLWRFGIDAYYLPGNVKETFTFPAAGEYRVA
FVARDNDGQYNETYQFITVN
Download sequence
Identical sequences A0A0F6A4W2
WP_052961164.1.25629 WP_052961164.1.44523 WP_052961164.1.44690 WP_052961164.1.91916 WP_052961164.1.98658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]