SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8AID5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AID5
Domain Number 1 Region: 664-794
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.45e-38
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 983-1081
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 20-102
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-19
Family PDZ domain 0.0067
Further Details:      
 
Domain Number 4 Region: 203-317
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000125
Family Phosphotyrosine-binding domain (PTB) 0.044
Further Details:      
 
Domain Number 5 Region: 928-997
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000222
Family UBX domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AID5
Sequence length 1476
Comment (tr|A0A0F8AID5|A0A0F8AID5_LARCR) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KKF18262.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_05543 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MRIQGQPEGARRRLDLNTIGELRGVEVIRGRAGYGFTISGQRPCLLSGILEGSPADLVGL
KQGDYIVSINGTDVSTALHETVVQLIGSCKGPLRMVVHTEGRTLGNPILNDAKFGIGQKS
GVLQKASVLRTISDDSSNSSFNSGHAITSKQRPVSEPDMSQWSQHWSSLAEQPKKENSRA
GDTDSVFTDTEEEANPDWSILNMTMVVGYLSSTELILNTTEPEEDCLKAIRERIRQLGTE
QDTHTLVMMKIMFDCVRLCDDTGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIINGRV
PEDGPLRASCHVFFVDPELGNHEDHIDIAGRFGFDCTPDPDALGCLEFPQTPPDVLHFVT
ILYSDMGEAVERLRAKLDMEAQEQAKENDSTGKQGSASSNGDSGIVNGSPPEERADRDFP
PAIQNHPGAHLPSCPWDYSPAKDLTPINLCENVQNLNPENSVSIHSLSESLPGPDCLTSL
YGGPPPRLEFQFKPPPPPLPLEKKTNFRDHLRGSQRWFSKPKWPKALSSDPELQVTSNNN
WSSSVSLSNLPPPMSQIPSDRYRSAEAMMLPPREEWTKRFLEQREKERKDGRTKNGSRFW
GMGVVRASKRRSAKRLSLARSLDDLESAASSDGDYSGVQLQGCCSQSSLNSNGSLTGAGS
HRGVPEQRVASWAACFEHLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSQVPATDKK
QLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPRPDMFKTQQLQIFNLMKFDSYS
RFLKSPLYQECMRAEVDGRPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKEVRKQRSGRS
LNEDSRDESADKKRGMFFSWSRNRSFGKGPKKKEIGDINLDYWGSNGRRESQGSLSSGTS
LEMATSCSAGKIESDNRHSVGVWERSSKHCSVMLPDGSCSSITLRPGASIREVLQDLCHG
ISVNIAAADLFLVGGEKPLVLDQDCMTLSSRDLRLEKRTLFRLDLVPINRSVGLKAKPTK
PVTEVLRPVVAKYGLHLSDLVAKISGETKPLDLGAPISSLDGLRVVLERADPASGKDKSK
SSSLKGHPPTRSFSATGDGRSTPKDFSVRPGGPDSALPGEKRKQKKINIDEAEGGPDSAL
PGEKRKQKKINIDEAEEFFELLSRAQSTRANDQRGLLNKDDLVLPDFLRLTPPDLACSTP
DSLKQTRENGVSSRGALTSSLRSESLDSSLSSSANGHSGTRRCLLPPPRHPTFGTHLSPI
SRPSDSRPSLRTVEEDAHADLTLVGEGDISSPNSTLLPPSPPSKSSFASSLPEANFTPPP
PCSNAGGEGKSSSALKAGSLLTPGQPYHPSGGQRRTRRRSFGSQPLSEDCSWVRSSLAEG
STDPSSSNTKSPADRADAAQTVQEVMDVEGVHLEEGTPPLETSQGEDSELSLSFQGYVAE
LRQCQSKMRNAQMPHNGRNPPEGKDCTTDLYKATVV
Download sequence
Identical sequences A0A0F8AID5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]