SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H0Y0C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0Y0C0
Domain Number 1 Region: 2-284
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-84
Family NagZ-like 0.000000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H0Y0C0
Sequence length 328
Comment (tr|A0A0H0Y0C0|A0A0H0Y0C0_VIBVL) N-acetyl-beta-glucosaminidase {ECO:0000256|HAMAP-Rule:MF_00364} KW=Complete proteome OX=1112911 OS=Vibrio vulnificus CladeA-yb158. GN=VVYB158_09125 OC=Vibrionaceae; Vibrio.
Sequence
MGPLWVDVAGYELNAEDKEILQHPSVGGLILFTRNYHDSEQLLALTAAIRQVVKRPFLIG
VDQEGGRVQRFRDGFSLIPAAAEYAKQANGEAMAQMGGWLMAAELIAHDIDLSFAPVLDQ
GFGCKAIGNRAFGEDTQTILRHSSAYMQGMKAVGMATTGKHFPGHGGVVADSHLETPFDQ
RSDIVEQDMAIFKTQIDAGLLDAMMPAHVIYPHYDPQPASGSEYWLKQVLRQQLGFKGLI
FSDDLTMEGAAVMGGPADRALQALNAGCDMLLMCNKRDAQVAALDALPIVEVPLALSLLK
KRSFSLSELKLAPQWKEARENMLRILGH
Download sequence
Identical sequences A0A0H0Y0C0 Q7MNL5
196600.VV0700 WP_011149563.1.34622 WP_011149563.1.79678 gi|37678884|ref|NP_933493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]