SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H0Y3T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0Y3T8
Domain Number 1 Region: 68-235
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.26e-42
Family Pseudouridine synthase RsuA/RluD 0.0013
Further Details:      
 
Domain Number 2 Region: 4-96
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000892
Family Ribosomal protein S4 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H0Y3T8
Sequence length 320
Comment (tr|A0A0H0Y3T8|A0A0H0Y3T8_VIBVL) Pseudouridine synthase {ECO:0000256|RuleBase:RU003887} KW=Complete proteome OX=1112911 OS=Vibrio vulnificus CladeA-yb158. GN=VVYB158_04900 OC=Vibrionaceae; Vibrio.
Sequence
MNEKLQKVLARAGHGSRRELEALIKSGRVSVNGIVAKLGERLEDEQAVVRIDGHVVSVKA
QEEVICRVLAYYKPEGELCTRHDPEGRRTVFDRLPKIRGSRWISVGRLDANTSGLLLFTT
DGELANRLMHPSRQVEREYLVRVFGEVNEHKVRNLVNGVELDDGLARFEDVVYTGGEGMN
HTFYVVINEGRNREVRRLWESQDCTVSRLKRVRYGDIYLDKKLPRGGWMELELKDVNYLR
ELVELRPEKETMIELNNSSRKRDRARSQKIRRAVKRHEERVSTPKGRSNNAARRKPSKAA
GQTSKTNSRNQAGSRSKPQR
Download sequence
Identical sequences A0A0H0Y3T8 A0A2J9Y262 Q7MM46
gi|320156837|ref|YP_004189216.1| 196600.VV1227 WP_011149934.1.25536 WP_011149934.1.33883 WP_011149934.1.34622 WP_011149934.1.54486 WP_011149934.1.55006 WP_011149934.1.58885 WP_011149934.1.66581 WP_011149934.1.73066 WP_011149934.1.79678 WP_011149934.1.8379 WP_011149934.1.90288 WP_011149934.1.99976 gi|37679411|ref|NP_934020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]