SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H0Y9A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H0Y9A3
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-48
Family Predicted metal-dependent hydrolase 0.000000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H0Y9A3
Sequence length 154
Comment (tr|A0A0H0Y9A3|A0A0H0Y9A3_VIBVL) Endoribonuclease YbeY {ECO:0000256|HAMAP-Rule:MF_00009, ECO:0000256|SAAS:SAAS00349114} KW=Complete proteome OX=1112911 OS=Vibrio vulnificus CladeA-yb158. GN=VVYB158_02825 OC=Vibrionaceae; Vibrio.
Sequence
MAIELDLQLAVEDQNGLPSAQDFQTWLDKTIPPFQPQAEVTIRIVDSQESHQLNHDYRGK
DKPTNVLSFPFEAPPGMEMDLLGDLVICRQVVEQEAIEQDKPLMAHWAHMVVHGSLHLLG
YDHIEDDEAEEMESLETEIMQGMGFTDPYLAEKE
Download sequence
Identical sequences A0A0H0Y9A3 A0A1L9L6L4 A0A1W6M1W1 Q7MN02
196600.VV0915 WP_011149714.1.16238 WP_011149714.1.21633 WP_011149714.1.22778 WP_011149714.1.33883 WP_011149714.1.34622 WP_011149714.1.53345 WP_011149714.1.55006 WP_011149714.1.58885 WP_011149714.1.66581 WP_011149714.1.79678 WP_011149714.1.81060 WP_011149714.1.81460 WP_011149714.1.90288 WP_011149714.1.93668 WP_011149714.1.94371 gi|229047214|ref|NP_933708.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]