SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2T5Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2T5Y0
Domain Number 1 Region: 5-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2T5Y0
Sequence length 180
Comment (tr|A0A0H2T5Y0|A0A0H2T5Y0_9BACT) 2-oxoacid:ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KLO25096.1} KW=Complete proteome OX=1428448 OS=Marinitoga sp. 1155. GN=X274_01015 OC=Bacteria; Thermotogae; Petrotogales; Petrotogaceae; Marinitoga.
Sequence
MKHHAFIAAGFGGQGVMLFGKILSLAAMYENLYTTWLPSYGPEMRGGTANCTVVVSEKYI
ASPVVDQPTEVIAFNIPSMYKFEKLLPENGILLLNSSVIDREPERKDVQIYKIPANDIAD
ELGNIKVQNMVMLGAYLKATNAVSFESVKAALEKSLKGKKADLLDINLKAIEAGMNALVK
Download sequence
Identical sequences A0A0H2SAZ1 A0A0H2T5Y0
WP_047264909.1.80891 WP_047264909.1.82344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]