SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2YQB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YQB9
Domain Number 1 Region: 8-404
Classification Level Classification E-value
Superfamily Clc chloride channel 1.1e-41
Family Clc chloride channel 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YQB9
Sequence length 418
Comment (tr|A0A0H2YQB9|A0A0H2YQB9_CLOP1) Voltage-gated chloride channel family protein {ECO:0000313|EMBL:ABG83018.1} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_0661 OC=Clostridium.
Sequence
MKKYFSLGILILYGIVLGGIVGAVSWLFLYVVSSGIHFMWNELPGKFNLPYWTILVCSIG
GILVGLCQKYLGEYPKLMPEVMAEFKETKRVDYKNVPKACVSALITLFFGASLGPEAALV
NIIGGLSTLVGDFLKWIVKDKELEKYDSLVTEFSMEATIGLIFHAPLIGLTPLIEDDDSS
VRKNIKTIVYSITTAAGFGVLILLSQIDNRPSFIVHFGSFNLGMSEIISIISLIICGILM
ALLYGGYGKILHKIFLPLKNYKIIRALIGGIILGIVGTWLPYTLFSGEHEVKVLVKEWSS
LSIRILILISLVKLFLTEVCLSTGWRGGHIFPVVFSGVSMGYALSAIFSIDPVVTVTIVT
TAFTSSVLRNAVVTLLLLVLFFPSSLIWIMLIAAFLSAYVLKRWDSRGNKEESVKKVI
Download sequence
Identical sequences A0A0H2YQB9
WP_011590299.1.50147 gi|110799384|ref|YP_695114.1| 195103.CPF_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]