SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2YRS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YRS2
Domain Number 1 Region: 410-566
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-26
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 343-422
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.86e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YRS2
Sequence length 583
Comment (tr|A0A0H2YRS2|A0A0H2YRS2_CLOP1) Putative sensor histidine kinase {ECO:0000313|EMBL:ABG83369.1} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_2673 OC=Clostridium.
Sequence
MFIVIFAVFIPVLYIILFGGYSFDNIAKLNSKANPDICNRVIYRDALINPHKYKECRLLA
QSVDISDFLYNETNYLSKLDSLETKEQKQAFIAKLQERATSYSGVVLINKKTGEYYSNRV
WFYEKPYNLSTPKEVLESLSKNDNVVFKEINSSDNYEEIYFSRGELYDSEINSIRIAFIA
TMTTTLLMLLLIIKKLVMIKNMGIRAYKDSWKNGYFFRFLDSLNVLITKKMFIEEFLKDK
VVMFVISFTIIYILINGFMRNIEFVWKQYHYVLTDNRYLWIIPIVLVIHFIVKFIRKYDG
LDTVIKGIEKVKKGDTDIEIKDNDDRQIRELADDVNDLRLGYKELVEEGIKNEKLKTELI
SNVSHDLKTPLTSIINYVNILQLNNIKEEERKEYIEILDKKSQTLKKLIDDLFEVSKMSS
GKVELFKYNIDIIQLVYQCIAEVEDVYSEKEIEFKINGPEECMVKIDPQRMSRVFQNLTT
NALKYSLEKTRVYVEIKDLENYVEISFKNISSYALDFDEKDILERFARGDESRNSTIEGS
GLGLAIAKTIVELHNGKFRVECEGDLFKAFVIIPKNKDDNNEE
Download sequence
Identical sequences A0A0H2YRS2
gi|110799735|ref|YP_697053.1| IDP04515 195103.CPF_2673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]