SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2YTA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YTA4
Domain Number 1 Region: 3-221,312-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.91e-47
Family FAD-linked reductases, N-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 220-311
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000576
Family D-aminoacid oxidase-like 0.016
Further Details:      
 
Weak hits

Sequence:  A0A0H2YTA4
Domain Number - Region: 383-404
Classification Level Classification E-value
Superfamily Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.0955
Family Ferredoxin thioredoxin reductase (FTR), catalytic beta chain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YTA4
Sequence length 473
Comment (tr|A0A0H2YTA4|A0A0H2YTA4_CLOP1) Oxidoreductase, FAD-binding {ECO:0000313|EMBL:ABG83744.1} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_0411 OC=Clostridium.
Sequence
MRDIIVIGAGVVGCSIARELSKYNLDVLVVEKNSDVSEGISKGNSGIVHAGYNEKIGTLK
AKLNIEGNKIFDDLSRDLQFPFKRNGAFILAFSDEEMKTLESLKENGEKLGVEGLEILTR
EEALNIEPNLNKKIVGVLNVKTSGIVSPYEMTIALAENAAENGVEFKLNSKVTSIEKISE
GYKVTLNNKEVVNGKLIINASGLEGAFLNNLVSMTKREINPVKGEYCLFDKVAGAMINKT
LFQVPNKLSKGVLVTPTAEGNLLVGPNAVEGKTLETSREGIDEILDKSKKSLEELPVARI
LNTFSGIRPKTKGGDFIIEEVEDAKNFINVIGIDSPGLTAAPAIGVYVVNMIKERLDLVE
KKNFKKTREKIVRFAELSLKEKNKLIKEKPAYGHMVCKCEFVTEGEIVEAIHRPIKALTV
DAIKRRTRASMGGCQGIGCTLPISKILSRELGIDISDINKNSEGSPVIGFKED
Download sequence
Identical sequences A0A0H2YTA4
195103.CPF_0411 gi|110800110|ref|YP_694868.1| WP_011590181.1.50147 WP_011590181.1.51349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]