SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2YVU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2YVU0
Domain Number 1 Region: 2-190,349-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-51
Family HI0933 N-terminal domain-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 191-352
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 5.75e-45
Family HI0933 insert domain-like 0.000088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2YVU0
Sequence length 406
Comment (tr|A0A0H2YVU0|A0A0H2YVU0_CLOP1) Pyridine nucleotide-disulphide oxidoreductase {ECO:0000313|EMBL:ABG84853.1} KW=Complete proteome OX=195103 OS=NCIMB 6125 / NCTC 8237 / Type A). GN=CPF_1339 OC=Clostridium.
Sequence
MAKVIVIGAGPAGMMAAISAAENHEVILLEGNERIGKKLFITGKGRCNVTNAKDISEFFD
FIPGNPHFLYSALYTYTNIDVMNFFENAGVKLKVERGSRVFPNSDKSSDIISGLSRGLNE
ALVDLRLHSKVKDVIFNNNKIEAVILENGSKVKGDYFIITTGGKSYPLTGSTGIGFDLAK
KMGHTIVEPKPSLVPIEIEESWVRELQGLSLRNIELKIKNKKNSKVVYSGQGEMLFTHFG
ISGPLVLSGSRFIKDGEKFEISLDLKPALEEKQLDLRIQKDFKKNLNKDFKNSLDELLPK
KLIPVIIELSKIDENKKVNSITKEERRTLLNLLKNLTFTVKGLRDIAEAIVTAGGVSTKE
IDPSTMQSKIVDNLYFAGEVIDVDAFTGGYNVQIALSTGYLAGKSI
Download sequence
Identical sequences A0A0H2YVU0 A0A174B7M3 B1RC43
WP_003460716.1.10161 WP_003460716.1.20964 WP_003460716.1.27537 WP_003460716.1.30163 WP_003460716.1.50147 WP_003460716.1.52260 WP_003460716.1.5234 WP_003460716.1.52659 WP_003460716.1.68380 WP_003460716.1.81392 gi|110801219|ref|YP_695785.1| 195103.CPF_1339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]