SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H3A7T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3A7T3
Domain Number 1 Region: 187-444
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.64e-65
Family PFOR Pyr module 0.029
Further Details:      
 
Domain Number 2 Region: 7-209
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 456-560
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.22e-17
Family Transketolase C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3A7T3
Sequence length 578
Comment (tr|A0A0H3A7T3|A0A0H3A7T3_DESVV) Pyruvate flavodoxin/ferredoxin oxidoreductase domain protein {ECO:0000313|EMBL:ABM28581.1} KW=Complete proteome OX=391774 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4). GN=Dvul_1564 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MQQAPRSIVIGGEAGQGLVTIGDMLVRTLIRSGYGVLVAQHYMSRVRGGHNTYNIRVGAG
DVLAPTDDVHVLVALDQRTVTEQGPRLGDGLLILDERLDPGSLNALRVPFAALAGRPLYE
NIAALGVLAALLGLERAPVDRLVGEAFHKKGDDVITRNLEVLEAAWRWASDHRAASEPLS
APEGPTGRMMLQGNEAIALGALAAGVKFCAFYPMTPATSVAQNLILHAERMGVVVEQAED
EIAAMNMVLGASYAGARALVPTSGGGFALMTEGVSLAGVMEQPVVIVLAQRPGPATGLPT
RTEQADLDLALYAGHGEFPRVIFAPATPEDCFHLTYAAFDLAERFQIPAFVLTDQYLADS
YRPVAPFDLDALPPLAEPDFSTDKGPEGDRYKRYELTESGISPRRIPGFSKSLVLADCHE
HTEQGYITEDVGLRIAMSDKRLRKGDGLRSMALPPRCFGDEVPDLLLACWGSSEGAVVEA
AQRLRARGRKVGVLSFTQVWPLEPSQFLSRCGEATEVVCIEGNATGQFSRLLRLAGVTVG
RTLLRYDGRPFTPEWIVAHLTAGDSGTSHMQTAKGASA
Download sequence
Identical sequences A0A0H3A7T3
391774.Dvul_1564 WP_011792346.1.63145 gi|120602608|ref|YP_967008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]