SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H3CQ44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3CQ44
Domain Number 1 Region: 13-371
Classification Level Classification E-value
Superfamily SIS domain 5.15e-52
Family double-SIS domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H3CQ44
Sequence length 382
Comment (tr|A0A0H3CQ44|A0A0H3CQ44_ENTCC) Tagatose-6-phosphate ketose/aldose isomerase {ECO:0000313|EMBL:ADF64054.1} KW=Complete proteome OX=716541 OS=NBRC 13535 / NCDC 279-56). GN=ECL_04525 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MPQITPTATTGTWTEEEIRQQPASWIRSLHNIDNLRSSIDSFLTPLLRKHDLRIVLTGAG
TSAFIGDIIAPWLAGHTGKNICAVPTTDLVTNPMDYFSPAHPLLLISFARSGNSPESVAA
VELANQFVPECYHLSITCNEAGNLYQSAIDSDNACALLMPAETHDRGFAMTSSITTMMAS
CLAVFAPETINSNTFRDVADRCQAILTSLGDFRHGVFGNEPWKRIVYLGSGGLQGAARES
ALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVFISSHPYTRQYDLDLLAELRRD
RQALRVVAIAAENDPVIEAGPHILLPPSRPFIDMEQAFCFLMYAQVFALSQSLSVGNTPD
TPSASGTVNRVVQGVVIHPWQA
Download sequence
Identical sequences A0A0H3CQ44 A0A0M7E019
gi|296104857|ref|YP_003615003.1| WP_013098893.1.40358 WP_013098893.1.55189 WP_013098893.1.92861 YP_003615003.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]