SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J0V267 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0V267
Domain Number 1 Region: 22-123,233-423
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-27
Family Tandem AAA-ATPase domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J0V267
Sequence length 443
Comment (tr|A0A0J0V267|A0A0J0V267_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KLR72410.1} KW=Complete proteome OX=1659191 OS=Geobacillus sp. T6. GN=ABH20_16345 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MGKKIYVLDTNVLLQDPYSIFAFEDNEVVIPAVVLEEVDSKKRYMDEIGRNARQVSKLID
RLRENGKLHEKIPLENGGALRIELNHRSFHQLQEIFVEKTNDNRILAVAKNLSLEEQAKE
DGRSVILVSKDALVRVKADAIGLQAEDFLSDRVVDVDHIYSGFLELYIGKDHLQRFYDKG
ELVLADIADHPFYPNQFIIMKDAFGSSASAIGIVDQNGKKVKKLIFHHEHIWGIRPRNVQ
QTMAFELLMRDDIPLVTLIGKAGTGKTLLALAAGLMQTEDLRTYKKLLVARPIVPMGKDL
GFLPGEKEEKLRPWMQPIFDNLEYLFNTKKPGELDAILAGMSSIEVEALTYIRGRSLPEQ
FIIIDEAQNLTKHEVKTILTRVGEKSKIILMGDPEQIDHPYLDEYNNGLTYVVEKFKDQK
IAGHIRLVKGERSALAQLAADLL
Download sequence
Identical sequences A0A098L5N3 A0A0E0TA03 A0A0J0V267 A0A0K2H5K1 A0A142CZ34 A0A1C3D4X4 A0A1V9C5Y9 A0A2H5KFQ2 G8MZJ2 L7ZXV0 Q5L120 T0NY09 V6VCN4
gi|448237244|ref|YP_007401302.1| gi|375008035|ref|YP_004981668.1| 235909.GK1075 gi|319766088|ref|YP_004131589.1| WP_011230575.1.100150 WP_011230575.1.17728 WP_011230575.1.20723 WP_011230575.1.22479 WP_011230575.1.25743 WP_011230575.1.38928 WP_011230575.1.50933 WP_011230575.1.57889 WP_011230575.1.59104 WP_011230575.1.65208 WP_011230575.1.70239 WP_011230575.1.78869 WP_011230575.1.80994 WP_011230575.1.8599 WP_011230575.1.86012 WP_011230575.1.91533 WP_011230575.1.9165 WP_011230575.1.93593 gi|56419610|ref|YP_146928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]