SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J6YB68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6YB68
Domain Number 1 Region: 27-111,211-445
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-74
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6YB68
Sequence length 452
Comment (tr|A0A0J6YB68|A0A0J6YB68_COCIT) Translation initiation factor eIF-2B subunit beta {ECO:0000313|EMBL:KMP04304.1} KW=Complete proteome; Reference proteome OX=404692 OS=Coccidioides immitis RMSCC 2394. GN=CIRG_03995 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MAAPAILPMTPSLSSYIQSLKQSSVEASTENLITLLKRRHIRQPHSCALATAHLLLRAMH
TNKSNDPATLIDHVKRIGRRLVSAQPRQLIVGNIVRRVLGMMRDEAESWKRDCGMMSDAG
SDDTRPHTPPHGGFHNLARLPTHPGGALEKLSHLDSLERPSFTGHVTAAPALPGTSMFNL
LSYPPESTDPNSPISVSRGEPDTSDDKPRDYRGEVFDGIKEILEELNQANDQIAAYALDH
IHSNEVILTHTASTTVQKFLLKAAAKRKFSVIQVESYPNNHDDTHATVTGIRSGDEERLT
PEAFQKPLIAQGITVILIPDSAVFALMSQVNKVILGTDCVLANGGLVAAAGTRLIANAAK
AHKTPVVVVSGVYKLSPVYPFDQQSLVEYGDPSAVLPYEDGELVDNIDVVNPLSDYVPAE
LIDLYITNIGGHAPSYLYRIVADHYRNEDVKL
Download sequence
Identical sequences A0A0J6YB68 J3K9P1
CIRT_03999 CIMG_11906T0 XP_001243229.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]