SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J8RWY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8RWY8
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily E set domains 0.00000343
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RWY8
Sequence length 228
Comment (tr|A0A0J8RWY8|A0A0J8RWY8_COCIT) Arrestin domain-containing protein {ECO:0000313|EMBL:KMU89660.1} KW=Complete proteome; Reference proteome OX=396776 OS=Coccidioides immitis H538.4. GN=CIHG_07467 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MYNRPESSQKVSDHLVTLGISLPRWSYGPLDPVSVYVQLSPNPDWISKARKVTIQKLTLT
IDEEIIYNHEGDEPQRKVKTLAKRSESVGMKLPEAGYITNLGLVFPARDLRDSDGILPRS
KPGFPFYAVTSFTTTASLYKIEYYLTVKAHLTSAKDIVLRQPIVVCPQDHVGCKEEMEAI
EQAAREARHINPDNPMLPLPTIVRAHDPYALNYINVAIVGNVKKPLID
Download sequence
Identical sequences A0A0J8RWY8
CIHT_07501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]