SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K1M190 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1M190
Domain Number 1 Region: 11-193
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.67e-55
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K1M190
Sequence length 195
Comment (tr|A0A0K1M190|A0A0K1M190_XANCJ) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=195709 OS=juglandis). GN=AKJ12_04880 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MSEMHAAAAQFDAMVIGASAGGVMALQALLSSLPADLPMPVLVVLHLPRDRTSHLAELMD
ARCALPVREAEDKQPLLAGSVTIAPPDYHLLVETRDSLALSMDAPVLFSRPAIDPLFESA
ADVFGQRLLAILLTGASSDGSAGVAAVRAVGGTAWIQRPDDAASPLMPASALAYAGADAV
LTLQAICSRLEAFHP
Download sequence
Identical sequences A0A0K1M190 A0A0L7HVJ6
WP_039528502.1.12253 WP_039528502.1.16868 WP_039528502.1.21803 WP_039528502.1.35753 WP_039528502.1.36740 WP_039528502.1.42037 WP_039528502.1.43890 WP_039528502.1.54137 WP_039528502.1.64274 WP_039528502.1.69051 WP_039528502.1.704 WP_039528502.1.73304 WP_039528502.1.80218 WP_039528502.1.81620 WP_039528502.1.9212 WP_039528502.1.97897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]